PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g31887.3.p
Common NameBRADI_2g31887, LOC100840729
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 862aa    MW: 95567.5 Da    PI: 5.1121
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g31887.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.73.2e-193884148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd+++++ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Bradi2g31887.3.p 38 KGPWSKEEDDIIIEMVNEHGPKKWSTIAQALP-GRIGKQCRERWHNHL 84
                      79******************************.*************97 PP

2Myb_DNA-binding54.52.6e-1790132145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       r++WT+eE+ +l++a++ +G++ W+  +++++ gRt++ +k++w+
  Bradi2g31887.3.p  90 RDAWTQEEEIRLIQAHQAYGNK-WAELSKYLP-GRTDNAIKNHWH 132
                       789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.9151332IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.0E-101445IPR009057Homeodomain-like
PROSITE profilePS5129431.853388IPR017930Myb domain
SuperFamilySSF466891.32E-3135131IPR009057Homeodomain-like
SMARTSM007173.0E-183786IPR001005SANT/Myb domain
CDDcd001676.55E-164084No hitNo description
PfamPF139212.8E-1841101No hitNo description
Gene3DG3DSA:1.10.10.601.4E-264691IPR009057Homeodomain-like
SMARTSM007171.0E-1589137IPR001005SANT/Myb domain
PROSITE profilePS5129419.97589139IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2292138IPR009057Homeodomain-like
CDDcd001677.57E-1292132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MMLDNRQHFC LPAECFRDRT DVQCLHRWQK VLNPELVKGP WSKEEDDIII EMVNEHGPKK  60
WSTIAQALPG RIGKQCRERW HNHLNPGINR DAWTQEEEIR LIQAHQAYGN KWAELSKYLP  120
GRTDNAIKNH WHSSVKKKFE SYRAEGLLAQ LKGLPPVVYP TSLTVDSSSA MIQQNSEGSG  180
LNAVLEVEDS SEFSQSSLAN VSCSQVKHVD AALGCHLQVN FCDERADDSY SLGQEACYTN  240
TNNVASALPE THHQLSISEN DLDKHLQQDF SEEMDLDIGE VPNSSVFTDS QASKELFQHT  300
QVISMLPTVS GYEHNTNATS EADFDNKKGL QSELWEDISF QGILSAPDSI SADSFLSPNC  360
QRGLYSVEAA KNFEESLYPL HTFNSSSMTS SAHLQSSATS LPSSFISSGS ASCTPGAKFE  420
TNGIPVSLES ITCQDVPSDM PIPESRKQQP TDVEQSSLEH TTMGREASPI HGESVVGQKK  480
HSEALCYEPP CFPSVEVPFV SCDLLSSSDL PEYSPLGIRE LMRSSMNFST PIRLWSSPTR  540
DMSSDAVLKS AAKSFICTPS IMKKRQRELS SPTPDIKFAK KIGAEKDCGN SGMSSTRTER  600
SFMDVIEDEL LDFISHQNEE NLKETTHQGI NEENTKRNTL EEGKRCSTMN KDTTCDALST  660
GILTESNANS LSPPKDVKNP GIQKLNTTAK SLSKEIISSR SKPTNLVVEK SSPYINADYQ  720
YVNILADTPG IKRGLESPSA WKSPLFTNFQ DGFFMSPAGR TFDALGLVKQ INEQNAPALE  780
EAHEVLACGR PQNPCSKENS NKENIEQTII REHVTSNQPS TVMAEARILD YNECTTPVKK  840
KEECSIFQRS PTSSYLLKNV R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-571813838158MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-571813838158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231589.10.0PREDICTED: myb-related protein 3R-1 isoform X2
TrEMBLA0A0Q3R0P80.0A0A0Q3R0P8_BRADI; Uncharacterized protein
STRINGBRADI2G31887.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-79Homeodomain-like protein